General Information

  • ID:  hor002350
  • Uniprot ID:  P06308
  • Protein name:  Beta-2-CDCP
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Molluscan ELH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RLRAS
  • Length:  5
  • Propeptide:  MKMSGLLSKPDYGVVGIVFTVVFCCWCSSSTTHALSIAEPGRDRYDKRSPTGHGVEVVESGEDYGSNRPQPVYGDEDEEDSADVYVGSDESSSGEKTRLTAAKRRLRFNKRRLRASKRRLRFHKRRVDSADESNDDGFDRKAREPRLRFHDVRKRSATAEEGSENAEIEESHLGNSRSRRSAGSAPSSANEVQRSKRLSITNDLRAIADSYLYDQHKLRERQEENLRRRFLELGKRGSAFFDHIPIIFGEPQYDYQPFK
  • Signal peptide:  MKMSGLLSKPDYGVVGIVFTVVFCCWCSSSTTHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CDCH induces ovulation and egg-mass production; it may also stimulate synthesis of secretory products in the female accessory sex glands and affect neurons in the neuronal circuits controlling locomotion and feeding.; Calfluxin is involved in the influx of calcium into mitochondria of the albumen gland.; CDCA (or alpha-CDCP) triggers the electrical activity of the caudodorsal cells (CDCS).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06308-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002350_AF2.pdbhor002350_ESM.pdb

Physical Information

Mass: 67323 Formula: C24H47N11O7
Absent amino acids: CDEFGHIKMNPQTVWY Common amino acids: R
pI: 12.5 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -84 Boman Index: -2651
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 98
Instability Index: 4652 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA